SARS MERS Spike S1 Recombinant

Item#:

rAP-5466

Please Inquire

Product Name	SARS MERS Spike S1 Recombinant
Synonyms
Description	Recombinant SARS MERS Spike S1 is a peptide from amino acids 56-295 of spike protein S1 produced in E. coli and fused to a 6xHis tag at its C-terminus (UniProt accession #AHC74088).SARS MERS is purified by a proprietary chromatographic technique.
Uniprot Accesion Number	AHC74088
Amino Acid Sequence	EAKPSGSVVEQAEGVECDFSPLLSGTPPQVYNFKRLVFTNCNYNLTKLLSLFSVNDFTCSQISPAAIASNCYSSLILDYFSYPLSMKSDLSVSSAGPISQFNYKQSFSNPTCLILATVPHNLTTITKPLKYSYINKCSRLLSDDRTEVPQLVNANQYSPCVSIVPSTVWEDGDYYRKQLSPLEGGGWLVASGSTVAMTEQLQMGFGITVQYGTDTNSVCPKLEFANDTKIASQLGNCVEYHHHHHH.
Source	Escherichia Coli.
Physical Appearance and Stability	Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Avoid multiple freeze-thaw cycles.
Formulation and Purity	SARS MERS protein solution is supplied in PBS, 25mM arginine and 0.05% sodium azide. Protein is >95% pure as determined by 12% PAGE (coomassie staining).
Application	Immunoassay.
Solubility
Biological Activity
Shipping Format and Condition	Lyophilized powder at room temperature.
Usage Statement	Our products are furnished for LABORATORY RESEARCH USE ONLY. They may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.