Home Page > RECOMBINANT PROTEIN > Viral Antigens >  HIV-1 Integrase Recombinant

HIV-1 Integrase Recombinant


Product Name HIV-1 Integrase Recombinant
Synonyms
Description The E.coli derived 36 kDa recombinant protein is a non-glycosylated polypeptide chain, containing the HIV-1 immunodominant regions from the pol protein (intergrase) and fused with a six histidines tag.
Uniprot Accesion Number
Amino Acid Sequencemfldgidkaqeehekyhsnwramasdfnlppvvakeivascdkcqlkgeamhgqvdcspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfilklagrwpvktihtdngsnftsttvkaacwwagikqefgipynpqsqgviesmnkelkkiigqvrdqaehlktavqmavfihnfkrkggiggysagerivdiiatdiqtkelqkqitkiqnfrvyyrdsrdplwkgpakllwkgegavviqdnsdikvvprrkakiirdygkqmagddcvasrqdedhhhhhh.
Source Escherichia Coli.
Physical Appearance and Stability HIV-1 Integrase although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.
Formulation and Purity 1.5M urea, 25mM Tris-HCl pH 8.0, 0.2% Triton-X & 50% Glycerol. Greater than 95.0% as determined by SDS-PAGE.
Application HIV-1 Integrase antigen is suitable for ELISA and Western blots, excellent antigen for early detection of HIV seroconvertors with minimal specificity problems.
Solubility
Biological Activity
Shipping Format and Condition Lyophilized powder at room temperature.
Usage Statement Our products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.

ANGIO-PROTEOMIE, ALL RIGHTS RESERVED