Home Page > RECOMBINANT PROTEIN > Recombinant Proteins >  Trypsin Porcine Recombinant

Trypsin Porcine Recombinant


Item#:
rAP-4995
Size Price Quantity
1.0 mg $70.00
2.5 mg $182.00
50.0 mg $1,260.00
Product Name Trypsin Porcine Recombinant
Synonyms
Description Recombinant Porcine Trypsin is free from any animal and human sources. Recombinant Porcine Trypsin expressed in Yeast and purified by standard chromatography techniques. Recombinant Porcine Trypsin is free from foreign enzymes such as carboxypeptidase A & chymotrypsin. Recombinant Human Trypsin is free from protease inhibitors such as PMSF and EDTA.
Uniprot Accesion Number
Amino Acid SequenceVGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYKSRIQVRLGEHNI DVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSRVATVSLPRSCA AAGTECLISGWGNTKSSGSSYPSLLQCLKAPVLSDSSCKSSYPGQITGNMICVGF LEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCAQKNKPGVYTKVCNYVNWI QQTIAAN.
Source Pichia Pastoris.
Physical Appearance and Stability Recombinant Porcine Trypsin should be stored at 2-8°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Formulation and Purity The Porcine Trypsin (2.98mg/ml) is formulated with 1mM HCl and 20mM CaCl2, pH-3.
Application
Solubility
Biological Activity 3,394 BAEE units/mg powder.
Shipping Format and Condition Lyophilized powder at room temperature.
Usage Statement Our products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.

ANGIO-PROTEOMIE, ALL RIGHTS RESERVED