| Product Name | Streptavidin Recombinant |
| Synonyms | |
| Description | Streptavidin Streptomyces Avidinii Recombinant produced in E.Coli. The molecular weight per tetramer is approximately 52kDa. |
| Uniprot Accesion Number | P22629 |
| Amino Acid Sequence | MAEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVKPSAAS. |
| Source | Escherichia Coli. |
| Physical Appearance and Stability | Streptavidin is shipped at ambient temperature, upon arrival store at -20°C. |
| Formulation and Purity | Lyophilized in 10mM potassium phosphate buffer pH 6.5. Greater than 98.0% as determined by SDS-PAGE and HPLC. |
| Application | |
| Solubility | It is recommended to reconstitute the lyophilized Streptavidin in sterile 18M-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions. |
| Biological Activity | |
| Shipping Format and Condition | Lyophilized powder at room temperature. |
| Usage Statement | Our products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals. |
