Ras-Related C3 Botulinum Toxin substrate 1 Human Recombinant

Item#:

rAP-4624

Please Inquire

Product Name	Ras-Related C3 Botulinum Toxin substrate 1 Human Recombinant
Synonyms	P21-RAC1, RAC-1, RAC1, RAS-like protein TC25, MIG5, Cell-migration-inducing gene 5 protein,Ras-related C3 botulinum toxin substrate 1, rho family small GTP binding protein Rac1, TC-25, MGC111543.
Description	Ras-Related C3 Botulinum Toxin substrate 1 Human Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 192 amino acids and having a molecular mass of 21.4 kDa.
Uniprot Accesion Number	P63000
Amino Acid Sequence	MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCP PPVKKRKRKCLLL.
Source	Escherichia Coli.
Physical Appearance and Stability	Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Avoid multiple freeze-thaw cycles.
Formulation and Purity	The protein solution contains 20mM Tris-HCl pH7.5, 2mM EDTA and 1mM DTT. Greater than 95.0% as determined by SDS-PAGE.
Application
Solubility
Biological Activity
Shipping Format and Condition	Lyophilized powder at room temperature.
Usage Statement	Our products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.