| Product Name | I-TAC Human Recombinant (CXCL11) |
| Synonyms | Small inducible cytokine B11, CXCL11, Interferon-inducible T-cell alpha chemoattractant, I-TAC, Interferon-gamma-inducible protein 9, IP-9, H174, Beta-R1, chemokine (C-X-C motif) ligand 11, IP9, b-R1, SCYB11, SCYB9B, MGC102770. |
| Description | I-TAC Human Recombinant (Interferon-inducible T-cell alpha chemoattractant) produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 73 amino acids and having a molecular mass of 8300 Dalton. The I-TAC is purified by proprietary chromatographic techniques. |
| Uniprot Accesion Number | O14625 |
| Amino Acid Sequence | FPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPKSKQARLIIKKVERKNF. |
| Source | Escherichia Coli. |
| Physical Appearance and Stability | Lyophilized I-TAC although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution I-TAC should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles. |
| Formulation and Purity | Lyophilized from a 0.2?m filtered concentrated (0.5mg/ml) solution in 20mM PB, pH 7.4, 100mM NaCl. Greater than 97.0% as determined by |
| Application | |
| Solubility | It is recommended to reconstitute the lyophilized I-TAC in sterile 18MO-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions. |
| Biological Activity | Determined by its ability to chemoattract human IL-2 activated T-Lymphocytes using a concentration range of 0.1-10.0 ng/ml. |
| Shipping Format and Condition | Lyophilized powder at room temperature. |
| Usage Statement | Our products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals. |
