| Product Name | Interleukin-8 Rabbit Recombinant (CXCL8) |
| Synonyms | IL-8, CXCL8, Monocyte-derived neutrophil chemotactic factor, MDNCF, T-cell chemotactic factor, Neutrophil-activating protein 1, NAP-1, Protein 3-10C, Granulocyte chemotactic protein 1, GCP-1, Monocyte-derived neutrophil-activating peptide, MONAP, Emoctakin, K60, NAF, LECT, LUCT, 3-10C, LYNAP, SCYB8, TSG-1, AMCF-I, b-ENAP. |
| Description | IL-8 Rabbit Recombinant is a full length secreted protein (79 amino acids - a.a. 23-101). The IL-8 is expressed in E.Coli. and fused to a N-terminal His tag, having a total MW of 12.24kDa. |
| Uniprot Accesion Number | P19874 |
| Amino Acid Sequence | AVLTRIGTELRCQCIKTHSTPFHPKFIKELRVIESGPHCANSEIIVKLVDGRELCLDPKEKWVQKVV QIFLKRAEQQES. |
| Source | Escherichia Coli. |
| Physical Appearance and Stability | Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Avoid multiple freeze-thaw cycles. |
| Formulation and Purity | The IL-8 solution (1mg/ml) contains 50mM Tris, 300mM NaCl, 10% Glycerol, pH 7.5. Greater than 90% as determined by SDS-PAGE. |
| Application | |
| Solubility | |
| Biological Activity | |
| Shipping Format and Condition | Lyophilized powder at room temperature. |
| Usage Statement | Our products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals. |
