Home Page > RECOMBINANT PROTEIN > Neurotrophins >  Ciliary Neurotrophic Factor Rat Recombinant

Ciliary Neurotrophic Factor Rat Recombinant
Product Name Ciliary Neurotrophic Factor Rat Recombinant
Synonyms HCNTF, CNTF, Ciliary Neurotrophic Factor.
Description CNTF Recombinant Rat produced in E.Coli is a single, non-glycosylated polypeptide chain containing 200 amino acids and having a molecular mass of 22834 Dalton. The CNTF is purified by proprietary chromatographic techniques.
Uniprot Accesion Number P20294
Amino Acid SequenceAFAEQTPLTL HRRDLSSRSIWLARKIRSDLTALMESYVKHQGLNKNINLDSVDGVPVASTDRWSEMTEAERLQENLQAYRTFQGMLTKLLEDQRVHFTPTEGDFHQAIHTLMLQVSAFAYQLEELMVLLEQKIPENEADGMPATVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRVISSHQMGISALESHYGAKDKQM.
Source Escherichia Coli.
Physical Appearance and Stability Lyophilized CNTF although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution CNTF should be stored at 4°C between 2-7 days and for future use below -18°C.Please prevent freeze-thaw cycles.
Formulation and Purity Lyophilized from a concentrated (1mg/ml) solution in water containing 0.025% NaHCO3. Greater than 99.0% as determined by
Application
Solubility It is recommended to reconstitute the lyophilized CNTF in sterile water or 0.4% NaHCO3 adjusted to pH 8-9, not less than 100µg/ml, which can then be further diluted to other aqueous solutions, preferably in presence of carrier protein.
Biological Activity Fully biologically active by its ability to phosphorylate STAT3 in several cells lines.
Shipping Format and Condition Lyophilized powder at room temperature.
Usage Statement Our products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.

ANGIO-PROTEOMIE, ALL RIGHTS RESERVED