| Product Name | Pramlintide |
| Synonyms | |
| Description | Pramlintide Synthetic is a single, non-glycosylated polypeptide chain containing 37 amino acids, having a molecular mass of 3949.4 Dalton and a Molecular formula of C171H267N51O53S2. |
| Uniprot Accesion Number | |
| Amino Acid Sequence | KCNTATCATNRLANFLVHSSNNFGPILPPTNVGSNTY-NH2. |
| Source | |
| Physical Appearance and Stability | Lyophilized Pramlintide although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Pramlintide should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles. |
| Formulation and Purity | The protein was lyophilized with no additives. Greater than 98.0% as determined by |
| Application | |
| Solubility | It is recommended to reconstitute the lyophilized Pramlintide in sterile 18MO-cm H2O not less than 100 µg/ml, which can then be further diluted to other aqueous solutions. The Pramlintide is also soluble in 1% Acetic Acid. |
| Biological Activity | |
| Shipping Format and Condition | Lyophilized powder at room temperature. |
| Usage Statement | Our products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals. |
