Home Page > RECOMBINANT PROTEIN > Growth Factors >  Vascular Endothelial Growth Factor Related Protein Rat Recombinant

Vascular Endothelial Growth Factor Related Protein Rat Recombinant


Product Name Vascular Endothelial Growth Factor Related Protein Rat Recombinant
Synonyms VEGF-C, Vascular endothelial growth factor C, VRP, Flt4 ligand, Flt4-L.
Description Vascular Endothelial Growth Factor C Rat Recombinant contains 129 amino acids residues and was fused to a His- tag (6x His) at the C-terminal end. As a result of glycosylation VEGF-C migrates as an 18-24 kDa protein in SDS-PAGE under reducing conditions.
Uniprot Accesion Number P16612
Amino Acid SequenceDTVKLAAAHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGAATNTFFKP PCVSVYRCGGCCNSEGLQCMNTSTGYLSKTLFEITVPLSQGPKPVTISFA NHTSCRCMSKLDVYRQVHSIIHHHHHH.
Source Sf9, Insect Cells.
Physical Appearance and Stability Lyophilized Vascular Endothelial Growth Factor-C although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution VEGF-C should be stored at 4°C between 2-7 days and for future use below -18°C.Please prevent freeze-thaw cycles.
Formulation and Purity Each mg of VEGF-C Rat contains 50mg BSA and PBS as buffer. Greater than 90.0% as determined by
Application
Solubility It is recommended to reconstitute the lyophilized Vascular Endothelial Growth Factor C in sterile 18MO-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
Biological Activity Measured by its ability to stimulate phosphorylation of the VEGFR-3/FLT-4 receptor in porcine aortic endothelial cells. The ED50 for this effect is typically 200-300ng/ml corresponding to a Specific Activity of 3,334-5,000IU/mg.
Shipping Format and Condition Lyophilized powder at room temperature.
Usage Statement Our products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.

ANGIO-PROTEOMIE, ALL RIGHTS RESERVED