Home Page > RECOMBINANT PROTEIN > Growth Factors >  Growth Hormone Binding Protein Human Recombinant

Growth Hormone Binding Protein Human Recombinant
Product Name Growth Hormone Binding Protein Human Recombinant
Synonyms GHR, GHBP, GH receptor, Somatotropin receptor.
Description Growth Hormone Binding Protein Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 248 amino acids and having a molecular mass of 28107.01 Dalton. GHR is purified by proprietary chromatographic techniques.
Uniprot Accesion Number P10912
Amino Acid SequenceAFSGSEATAAILSRAPWSLQSVNPGLKTNS SKEPKFTKCRSPERETFSCHWTDEVHHGTKNLGPIQLFYTRRNTQEWTQEWKECPDYVSA GENSCYFNSSFTSIWIPYCIKLTSNGGTVDEKCFSVDEIVQPDPPIALNWTLLNVSLTGI HADIQVRWEAPRNADIQKGWMVLEYELQYKEVNETKWKMMDPILTTSVPVYSLKVDKEYE VRVRSKQRNSGNYGEFSEVLYVTLPQMSQFTCEEDFYF.
Source Escherichia Coli.
Physical Appearance and Stability Lyophilized Growth Hormone Binding Protein although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution GHBP should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.
Formulation and Purity GHBP was lyophilized from a concentrated (1mg/ml) solution with 0.0045mM NaHCO3. Greater than 98.0% as determined by
Application
Solubility It is recommended to reconstitute the lyophilized Growth Hormone Binding Protein in sterile 18MO-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
Biological Activity GHBP is fully biologically active as evidenced by its ability of forming 2
Shipping Format and Condition Lyophilized powder at room temperature.
Usage Statement Our products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.

ANGIO-PROTEOMIE, ALL RIGHTS RESERVED