Home Page > RECOMBINANT PROTEIN > Enzymes >  Secreted Phospholipase A2-X Human Recombinant

Secreted Phospholipase A2-X Human Recombinant


Product Name Secreted Phospholipase A2-X Human Recombinant
Synonyms Group 10 secretory phospholipase A2, EC 3.1.1.4, Group X secretory phospholipase A2, Phosphatidylcholine 2-acylhydrolase GX, GX sPLA2, sPLA2-X, SPLA2, GXPLA2, MGC119918, MGC119919, MGC133367, PLA2G10.
Description Secreted Phospholipase A2-X Human Recombinant is manufactured with N-terminal fusion HisTag. PLA2G10 His-Tagged Fusion Protein, is 15.5 kDa containing 123 amino acid residues of the human secreted phospholipase A2-X and 16 additional amino acid residues - HisTag (underlined).MRGSHHHHHHGMASHMGILELAGTVGCVGPRTPIAYMKYGCFCGLGGHGQPRDAIDWCCHGHDCCYTRAEEAGCSPKTERYSWQCVNQSVLCGPAENKCQELLCKCDQEIANCLAQTEYNLKYLFYPQFLCEPDSPKCD.
Uniprot Accesion Number O15496

Amino Acid Sequence

Source Escherichia Coli.
Physical Appearance and Stability Store lyophilized protein at -20°C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. Reconstituted protein can be stored at 4°C for a limited period of time; it does not show any change after two weeks at 4°C.
Formulation and Purity Sterile filtered and lyophilized from 0.5 mg/ml in 0.01M Tris buffer pH 7.2. Greater than 95% as determined by SDS PAGE.
Application
Solubility Add 0.2 ml of distilled water and let the lyophilized pellet dissolve completely.
Biological Activity
Shipping Format and Condition Lyophilized powder at room temperature.
Usage Statement Our products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.

ANGIO-PROTEOMIE, ALL RIGHTS RESERVED