Home Page > RECOMBINANT PROTEIN > Enzymes >  Secreted Phospholipase A2-IIE Human Recombinant

Secreted Phospholipase A2-IIE Human Recombinant


Item#:
rAP-1814
Size Price Quantity
2.0 ug $70.00
10.0 ug $182.00
1000.0 ug $5,460.00
Product Name Secreted Phospholipase A2-IIE Human Recombinant
Synonyms Group IIE secretory phospholipase A2, EC 3.1.1.4, Phosphatidylcholine 2-acylhydrolase GIIE, GIIE sPLA2, sPLA(2)-IIE, sPLA2-IIE, PLA2G2E.
Description Secreted Phospholipase A2-IIE Human Recombinant manufactured with N-terminal His-Tag. PLA2G2E His-Tagged Fusion Protein is 15.8 kDa protein containing 123 amino acid residues of the human secreted phospholipase A2-IIE and 16 additional amino acid residues ¿ His-Tag (underlined).MRGSHHHHHHGMASHMNLVQFGVMIEKMTGKSALQYNDYGCYCGIGGSHWPVDQTDWCCHAHDCCYGRLEKLGCEPKLEKYLFSVSERGIFCAGRTTCQRLTCECDKRAALCFRRNLGTYNRKYAHYPNKLCTGPTPPC.
Uniprot Accesion Number Q9NZK7

Amino Acid Sequence

Source Escherichia Coli.
Physical Appearance and Stability Store lyophilized protein at -20°C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. Reconstituted protein can be stored at 4°C for a limited period of time; it does not show any change after two weeks at 4°C.
Formulation and Purity Sterile filtered and lyophilized from 0.5 mg/ml in 0.05M Acetate buffer pH-4. Greater than 95% as determined by SDS PAGE.
Application
Solubility Add 0.2 ml of 0.1M Acetate buffer pH-4 and let the lyophilized pellet dissolve completely. For conversion into higher pH value, we recommend intensive dilution by relevant buffer to a concentration of 10 µg/ml. In higher concentrations the solubility of this antigen is limited.
Biological Activity
Shipping Format and Condition Lyophilized powder at room temperature.
Usage Statement Our products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.

ANGIO-PROTEOMIE, ALL RIGHTS RESERVED