Tumor Necrosis Factor Receptor Type Human Recombinant, His Tag

Item#:

rAP-0772

Product Name	Tumor Necrosis Factor Receptor Type Human Recombinant, His Tag
Synonyms	Tumor necrosis factor receptor superfamily member 1A, Tumor necrosis factor receptor 1, Tumor necrosis factor receptor type I, TNF-R1, TNF-RI, TNFR-I, p60, p55, CD120a, TNFRSF1A, TNFAR, TNFR1, FPF, TBP1, TNF-R, p55-R, TNFR55, TNFR60, TNF-R-I, TNF-R55, MGC19588.
Description	TNFR Human Recombinant produced in E.Coli is a single, non-glycosylated, Polypeptide chain containing 161 amino acids fragment (41-201) having a molecular weight of 22.68kDa and fused with a 4.5kDa amino-terminal hexahistidine tag. The TNFR His Tag is purified by proprietary chromatographic techniques.
Uniprot Accesion Number	P19438
Amino Acid Sequence	DSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSNCKKSLECTKLCLPQIEN.
Source	Escherichia Coli.
Physical Appearance and Stability	Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. Please avoid freeze thaw cycles.
Formulation and Purity	TNFR His Tag protein is supplied in 1xPBS, 50% glycerol. Greater than 95.0% as determined by SDS-PAGE.
Application
Solubility
Biological Activity
Shipping Format and Condition	Lyophilized powder at room temperature.
Usage Statement	Our products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.