Home Page > RECOMBINANT PROTEIN > Cytokines >  Interferon-Alpha 2b Human Recombinant

Interferon-Alpha 2b Human Recombinant


Item#:
rAP-0453
Size Price Quantity
20.0 ug $70.00
100.0 ug $182.00
1000.0 ug $1,260.00
Product Name Interferon-Alpha 2b Human Recombinant
Synonyms Interferon alpha 2b, IFNA, INFA2, MGC125764, MGC125765.
Description Interferon-a 2b Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 166 amino acids and having a molecular mass of 19400 Dalton.The Interferon-alpha 2b gene was obtained from human leukocytes.The IFN-a 2b is purified by proprietary chromatographic techniques.
Uniprot Accesion Number Q86UP4
Amino Acid SequenceMCDLPQTHSLGSRRTLMLLAQMRRISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLF STMDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSP CAWEVVRAEIMRSFSLSTNLQESLRSKE.
Source Escherichia Coli.
Physical Appearance and Stability Lyophilized Interferon although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IFN alpha 2b should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.
Formulation and Purity Lyophilized from a (1 mg/ml) solution in containing 2.3 mg Sodium phosphate dibasic and 0.55 mg sodium phosphate monobasic buffer. Greater than 98.0% as determined by(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE.
Application
Solubility It is recommended to reconstitute the lyophilized Interferon-alpha 2b in sterile 18MO-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
Biological Activity The specific activity as determined in a viral resistance assay using bovine kidney MDBK cells was found to be 260,000,000 IU/ mg.
Shipping Format and Condition Lyophilized powder at room temperature.
Usage Statement Our products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.

ANGIO-PROTEOMIE, ALL RIGHTS RESERVED