Adiponectin Human Recombinant

Item#:

rAP-0287

Please Inquire

Product Name	Adiponectin Human Recombinant
Synonyms	Acrp30, AdipoQ, GBP-28, APM-1, ACDC.
Description	The Adiponectin Human recombinant protein is a single, non-glycosilated polypeptide chain produced in E. coli, having a molecular weight of 25.1 kDa and containing 231 amino acids (15-244).
Uniprot Accesion Number	Q15848
Amino Acid Sequence	MGHDQETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGEKGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN.
Source	Escherichia Coli.
Physical Appearance and Stability	Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Avoid multiple freeze-thaw cycles.
Formulation and Purity	Acrp30 protein solution contains Phosphate buffered saline pH 7.4 and 1mM DTT. Acrp30 purity is greater than 90% as determined by SDS-PAGE.
Application
Solubility
Biological Activity
Shipping Format and Condition	Lyophilized powder at room temperature.
Usage Statement	Our products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.