Home Page > RECOMBINANT PROTEIN > Viral Antigens >  West Nile Virus Pre-M Recombinant

West Nile Virus Pre-M Recombinant


Item#:
rAP-5505
Size Price Quantity
100.0 ug $150.00
500.0 ug $600.00
1000.0 ug $1,200.00
Product Name West Nile Virus Pre-M Recombinant
Synonyms
Description The E.Coli derived 20kda recombinant protein contains the West-Nile N-Terminal Pre-M Virus immunodominant regions. The protein is fused with 6xHis tag.
Uniprot Accesion Number
Amino Acid SequenceMVTLSNFQGKVMMTVNATDVTDVITIPTAAGKNLCIVRA MDVGYLCEDTITYECPVLAAGNDPEDIDCWCTKSSVYVRYGRCTKTRHSRRSRRSLTVQTHGESTLANKKGAWLDSTKATRYLVKTESWILRNPGYALE.
Source Escherichia Coli.
Physical Appearance and Stability WNV Pre-M although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.
Formulation and Purity 20mM phosphate buffer pH 7.5. Protein is >95% pure as determined by SDS-PAGE.
Application Antigen in ELISA and Western blots, excellent antigen for detection of West-Nile virus with minimal specificity problems.
Solubility
Biological Activity
Shipping Format and Condition Lyophilized powder at room temperature.
Usage Statement Our products are furnished for LABORATORY RESEARCH USE ONLY.They may not be used as drugs,agricultural or pesticidal products, food additives or household chemicals.

ANGIO-PROTEOMIE, ALL RIGHTS RESERVED