Home Page > RECOMBINANT PROTEIN > Growth Factors >  Vascular Endothelial Growth Factor (121 a.a.) Human Recombinant, Sf9

Vascular Endothelial Growth Factor (121 a.a.) Human Recombinant, Sf9


Item#:
rAP-2490
Size Price Quantity
2.0 ug $50.00
10.0 ug $130.00
1000.0 ug $5,100.00
Product Name Vascular Endothelial Growth Factor (121 a.a.) Human Recombinant, Sf9
Synonyms Vascular endothelial growth factor A, VEGF-A, Vascular permeability factor, VPF, VEGF, MGC70609.
Description Vascular Endothelial Growth Factor-121 Human Recombinant produced in insect cells as an 18kDa homodimer, is a glycosylated, polypeptide chain containing 121 amino acids and having a molecular mass of approximately 36kDa.VEGF121 circulates more freely than other VEGF forms, which bind more tightly with vascular heparin sulfates.The VEGF-121 is purified by proprietary chromatographic techniques.
Uniprot Accesion Number P15692
Amino Acid SequenceAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPS CVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHN KCECRPKKDRARQEKCDKPRR.
Source Sf9, Insect Cells.
Physical Appearance and Stability Lyophilized Vascular Endothelial Growth Factor 121 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution VEGF-121 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.
Formulation and Purity The protein was lyophilized from a solution containing 50mM acetic acid. Greater than 95.0% as determined by SDS-PAGE.
Application
Solubility The lyophilized VEGF121 should be reconstituted in 50mM acetic acid to a concentration not lower than 50µg/ml.
Biological Activity Measured in a cell proliferation assay using primary HUVECs. The ED50 for this effect is typically 2-10ng/ml.
Shipping Format and Condition Lyophilized powder at room temperature.
Usage Statement Our products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
N
N

ANGIO-PROTEOMIE, ALL RIGHTS RESERVED